PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625372.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 287aa    MW: 33006.2 Da    PI: 8.7216
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625372.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k +G g+W++ +r  g+ R++k+c++rw +yl
   XP_013625372.1 14 KGAWTKEEDERLVSYIKSHGEGCWRSLPRAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding51.32.7e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T +Ede +++++ + G++ W++Ia++++ gRt++++k++w+++
   XP_013625372.1  67 RGNFTRDEDEVIINLHSLIGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-23564IPR009057Homeodomain-like
PROSITE profilePS5129417.094961IPR017930Myb domain
SuperFamilySSF466895.24E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.9E-151461IPR001005SANT/Myb domain
CDDcd001671.03E-91661No hitNo description
PROSITE profilePS5129426.85562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2765116IPR009057Homeodomain-like
SMARTSM007173.1E-1566114IPR001005SANT/Myb domain
PfamPF002491.9E-1467111IPR001005SANT/Myb domain
CDDcd001679.94E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009751Biological Processresponse to salicylic acid
GO:1900384Biological Processregulation of flavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRSPCCEKE HMNKGAWTKE EDERLVSYIK SHGEGCWRSL PRAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TRDEDEVIIN LHSLIGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLLSKG  120
IDPNTHRSIN AGKVSDSKKT EDQVVKDVSF GYLFDKTEKS EEQKQNKKQK QNLINGLVCK  180
EERVEHHPAV VVQEIFCPNL NLELRISPPW HNKNHDDNTR EKSTTYTTSR LYVQNGMESS  240
SDTAKCQTED SSSISHSSLD ISSISSVGYD FLGLNTRFMD FRSLEMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756520.0KM975652.1 Brassica napus MYB transcription factor 7.1 (MYB7.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625372.10.0PREDICTED: transcription factor MYB32
SwissprotO496081e-112MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A078K2S70.0A0A078K2S7_BRANA; BnaCnng76050D protein
TrEMBLA0A0D3BE140.0A0A0D3BE14_BRAOL; Uncharacterized protein
STRINGBra013055.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-140myb domain protein 7